PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA30G00282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 224aa    MW: 26117.1 Da    PI: 8.2279
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA30G00282genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.41.4e-12126181459
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                  k+ +r+++NRe+ArrsR RK+  ie+L++ v  L+ eN++L ++l     +++++
  AA30G00282 126 EKKRKRMESNRESARRSRMRKQTHIENLQNQVNRLDLENRELLNRLRLVLYQIQRV 181
                 5999*************************************999887766666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.3E-16123187IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-11124173No hitNo description
PROSITE profilePS5021711.277125188IPR004827Basic-leucine zipper domain
PfamPF001702.7E-10127174IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-11127176No hitNo description
CDDcd147025.24E-17128175No hitNo description
PROSITE patternPS000360130145IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MLSTVPAFTE PGLVNQFPGY QTGFTPLEWD WDFTNFFSLN QSSLEPVLPS PCFVESDTGS  60
VRINSGLQTG SDESCTGSIK IKQGFNVTNS SKSEEPDSND TNSGSVKQNH NRNYELNQQV  120
FPVNDEKKRK RMESNRESAR RSRMRKQTHI ENLQNQVNRL DLENRELLNR LRLVLYQIQR  180
VNTDNNRLVT EQEILRRRLS EMRQILILQQ WEQNRSLITN HQMI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139146RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446630.18e-92PREDICTED: LOW QUALITY PROTEIN: basic leucine zipper 61
TrEMBLV4MAA13e-87V4MAA1_EUTSA; Uncharacterized protein
STRINGAT4G37730.11e-83(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78551840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37730.14e-71basic leucine-zipper 7